PDB entry 3e0e

View 3e0e on RCSB PDB site
Description: Crystal structure of a domain of replication protein A from Methanococcus maripaludis. NorthEast Structural Genomics targe MrR110B
Deposited on 2008-07-31, released 2008-09-30
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.234
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: replication protein a
    Species: Methanococcus maripaludis [TaxId:39152]
    Gene: rpa, MMP1032
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6LYF9 (1-95)
      • expression tag (0)
      • expression tag (96)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3e0eA (A:)
    mnykiselmpnlsgtinaevvtaypkkefsrkdgtkgqlkslflkddtgsirgtlwnela
    dfevkkgdiaevsgyvkqgysgleisvdnigiieksl
    

    Sequence, based on observed residues (ATOM records):
    >3e0eA (A:)
    mnykiselmpnlsgtinaevvtaypkkefstkgqlkslflkddtgsirgtlwneladfev
    kkgdiaevsgyvkqggleisvdnigiieksl