PDB entry 3e0b

View 3e0b on RCSB PDB site
Description: Bacillus anthracis Dihydrofolate Reductase complexed with NADPH and 2,4-diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (UCP120B)
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2008-07-31, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.193
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: dfrA, BAS2083, BA_2237, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (4-165)
      • expression tag (0-3)
      • engineered (5)
    Domains in SCOPe 2.07: d3e0ba1, d3e0ba2
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: dfrA, BAS2083, BA_2237, GBAA2237
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R22 (4-165)
      • expression tag (0-3)
      • engineered (5)
    Domains in SCOPe 2.07: d3e0bb1, d3e0bb2
  • Heterogens: NDP, N22, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e0bA (A:)
    hhhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplp
    grrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitk
    ihhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e0bB (B:)
    hhhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplp
    grrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitk
    ihhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq