PDB entry 3dzw

View 3dzw on RCSB PDB site
Description: Structure of Narcissus pseudonarcissus lectin complex with Mannobiose at 1.7 A resolution, form II
Class: sugar binding protein
Keywords: lectin, agglutinin, mannobiose, mannose-alpha1, 3-mannose, daffodil, sugar binding protein
Deposited on 2008-07-30, released 2009-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin
    Species: Narcissus pseudonarcissus [TaxId:39639]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DZW (0-108)
    Domains in SCOPe 2.08: d3dzwa_
  • Chain 'B':
    Compound: agglutinin
    Species: Narcissus pseudonarcissus [TaxId:39639]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DZW (0-108)
    Domains in SCOPe 2.08: d3dzwb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3dzwA (A:)
dnilysgetlspgeflnngryvfimqedcnlvlydvdkpiwatntggldrrchlsmqsdg
nlvvysprnnpiwasntggengnyvcvlqkdrnvviygtarwatgtnih

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3dzwB (B:)
dnilysgetlspgeflnngryvfimqedcnlvlydvdkpiwatntggldrrchlsmqsdg
nlvvysprnnpiwasntggengnyvcvlqkdrnvviygtarwatgtnih