PDB entry 3dzk

View 3dzk on RCSB PDB site
Description: Crystal structure of human CD38 extracellular domain, NMN complex
Class: hydrolase
Keywords: NMN complex, BETA SHEETS, ALPHA BUNDLE, Alternative splicing, Diabetes mellitus, Glycoprotein, Hydrolase, Membrane, NAD, Polymorphism, Receptor, Signal-anchor, Transmembrane
Deposited on 2008-07-29, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.176
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28907 (6-End)
      • engineered (10)
      • engineered (61)
      • engineered (125)
      • engineered (170)
      • engineered (180)
    Domains in SCOPe 2.07: d3dzka_
  • Chain 'B':
    Compound: ADP-ribosyl cyclase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28907 (6-End)
      • engineered (10)
      • engineered (61)
      • engineered (125)
      • engineered (170)
      • engineered (180)
    Domains in SCOPe 2.07: d3dzkb_
  • Heterogens: NMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dzkA (A:)
    kreaearwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhp
    cditeedyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdlt
    wcgefdtskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdk
    dstfgsvevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckni
    yrpdkflqcvknpedssctsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dzkA (A:)
    rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
    dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefd
    tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
    vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
    lqcvknpedssc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dzkB (B:)
    kreaearwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhp
    cditeedyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdlt
    wcgefdtskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdk
    dstfgsvevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckni
    yrpdkflqcvknpedssctsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dzkB (B:)
    rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
    dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefd
    tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
    vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
    lqcvknpedssc