PDB entry 3dy6

View 3dy6 on RCSB PDB site
Description: PPARdelta complexed with an anthranilic acid partial agonist
Class: transcription
Keywords: PPAR, nulear receptor, Activator, DNA-binding, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc-finger
Deposited on 2008-07-25, released 2008-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.219
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: HOMO SAPIENS
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dy6a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: HOMO SAPIENS
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dy6b_
  • Heterogens: IOD, DY6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dy6A (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dy6A (A:)
    vadlkafskhiynaylknfnmtkkkarsiltapfvihdietlwqaekglvwglppykeis
    vhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdg
    llvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrp
    glmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikk
    tetetslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dy6B (B:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dy6B (B:)
    dlkafskhiynaylknfnmtkkkarsiltapfvihdietlwqaekglvwglppykeisvh
    vfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgll
    vangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpgl
    mnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikkte
    tetslhpllqeiykd