PDB entry 3dxt

View 3dxt on RCSB PDB site
Description: Crystal structure of the catalytic core domain of JMJD2D
Class: oxidoreductase, nuclear protein
Keywords: JMJD2D, JMJC, histone demethylase, H3K9, JUMONJI domain-containing protein 2D, oxidoreductase, Chromatin regulator, Dioxygenase, Iron, Metal-binding, Nucleus, Transcription, Transcription regulation, NUCLEAR PROTEIN
Deposited on 2008-07-25, released 2009-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: JmjC domain-containing histone demethylation protein 3D
    Species: Homo sapiens [TaxId:9606]
    Gene: jmjd2d
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dxta_
  • Heterogens: ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dxtA (A:)
    metmkskancaqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkar
    etydniseiliatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfed
    lerkywknriynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpyl
    yfgmwkttfawhtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcga
    flrhkvalisptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprw
    idygkmasqcscgearvtfsmdafvrilqperydlwkrgqdravvdhmeprvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dxtA (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrgqd