PDB entry 3dx9

View 3dx9 on RCSB PDB site
Description: Crystal Structure of the DM1 TCR at 2.75A
Class: immune system
Keywords: MHC, Glycoprotein, Glycation, Host-virus interaction, Immune response, Membrane, IMMUNE SYSTEM
Deposited on 2008-07-24, released 2009-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DM1 T cell receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DX9 (0-197)
    Domains in SCOPe 2.06: d3dx9a1, d3dx9a2
  • Chain 'B':
    Compound: DM1 T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DX9 (0-243)
    Domains in SCOPe 2.06: d3dx9b1, d3dx9b2
  • Chain 'C':
    Compound: DM1 T cell receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DX9 (0-197)
    Domains in SCOPe 2.06: d3dx9c1, d3dx9c2
  • Chain 'D':
    Compound: DM1 T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DX9 (0-243)
    Domains in SCOPe 2.06: d3dx9d1, d3dx9d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dx9A (A:)
    akttqptsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyycivwggyqkvtfgtgtklqvipiqnpdpavyqlr
    dskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfac
    anafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dx9B (B:)
    tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
    sdrfsaerpkgsfstleiqrteqgdsamylcasryrddsyneqffgpgtrltvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dx9C (C:)
    akttqptsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
    liitedrksstlilphatlrdtavyycivwggyqkvtfgtgtklqvipiqnpdpavyqlr
    dskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfac
    anafnnsiipedtffpsp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dx9D (D:)
    tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
    sdrfsaerpkgsfstleiqrteqgdsamylcasryrddsyneqffgpgtrltvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad