PDB entry 3dwy

View 3dwy on RCSB PDB site
Description: Crystal Structure of the Bromodomain of Human CREBBP
Class: transferase
Keywords: bromodomain, CREB binding protein, structural genomics consortium, SGC, Activator, Disease mutation, Host-virus interaction, Metal-binding, Methylation, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Transferase, Zinc-finger
Deposited on 2008-07-23, released 2008-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dwya_
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dwyb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dwyA (A:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwyA (A:)
    ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
    tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dwyB (B:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwyB (B:)
    fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt
    gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl