PDB entry 3dwk

View 3dwk on RCSB PDB site
Description: Identification of Dynamic Structural Motifs Involved in Peptidoglycan Glycosyltransfer
Class: transferase
Keywords: lysozyme-fold transpeptidase fold pi-helix, Cell shape, Cell wall biogenesis/degradation, Membrane, Peptidoglycan synthesis, TRANSFERASE
Deposited on 2008-07-22, released 2008-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.218
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein 2
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: pbp2, SACOL1490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dwka1, d3dwka2
  • Chain 'B':
    Compound: Penicillin-binding protein 2
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: pbp2, SACOL1490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dwkb1, d3dwkb2
  • Chain 'C':
    Compound: Penicillin-binding protein 2
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: pbp2, SACOL1490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dwkc1, d3dwkc2
  • Chain 'D':
    Compound: Penicillin-binding protein 2
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: pbp2, SACOL1490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dwkd1, d3dwkd2
  • Heterogens: SO4, LDA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dwkA (A:)
    mlqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldyk
    rlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddi
    fqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaae
    drkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdseynsyvnfvk
    selmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdqqvgatilds
    ktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatnhaiqdessy
    qvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkfaaklglnye
    gdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvtrdgetieydhtshka
    msdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqynlpdnaakdv
    wingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissrdgedfkrps
    svsgsipsinvsgsqdnnttnrsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwkA (A:)
    dpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldykrlf
    gstltqqvvkdaflsigrkaqeaylsyrleqeyskddifqvylnkiyysdgvtgikaaak
    yyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedrkntvlylmhyhkritdkqwe
    dakkidlkanlvnrtpeerqndseynsyvnfvkselmnnkafkdenlgnvlqsgikiytn
    mdkdvqktlqndvdngsfyknkdqqvgatildsktgglvaisggrdfkdvvnrnqatdph
    ptgsslkpflaygpaienmkwatnhaiqdessyqvdgstfrnydtkshgtvsiydalrqs
    fnipalkawqsvkqnagndapkkfaaklglnyegdigpsevlggsasefsptqlasafaa
    ianggtynnahsiqkvvtrdgetieydhtshkamsdytaymlaemlkgtfkpygsayghg
    vsgvnmgaktgtgtygaetysqynlpdnaakdvwingftpqytmsvwmgfskvkqygens
    fvghsqqeypqflyenvmskissrdgedfkrpssvsgsipsinvsgsqdnnttnrsth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dwkB (B:)
    mlqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldyk
    rlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddi
    fqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaae
    drkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdseynsyvnfvk
    selmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdqqvgatilds
    ktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatnhaiqdessy
    qvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkfaaklglnye
    gdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvtrdgetieydhtshka
    msdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqynlpdnaakdv
    wingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissrdgedfkrps
    svsgsipsinvsgsqdnnttnrsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwkB (B:)
    dpipakiydkngelvktldgqrhehvnlkdvpksmkdavlatednrfyehgaldykrlfg
    aigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddifqvy
    lnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedrkn
    tvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdseynsyvnfvkselm
    nnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdqqvgatildsktgg
    lvaisggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatnhaiqdessyqvdg
    stfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkfaaklglnyegdig
    psevlggsasefsptqlasafaaianggtynnahsiqkvvtrdgetieydhtshkamsdy
    taymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqynlpdnaakdvwing
    ftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissrdgedfkrpssvsg
    sipsinvsgsqdnnttnrsth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dwkC (C:)
    mlqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldyk
    rlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddi
    fqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaae
    drkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdseynsyvnfvk
    selmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdqqvgatilds
    ktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatnhaiqdessy
    qvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkfaaklglnye
    gdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvtrdgetieydhtshka
    msdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqynlpdnaakdv
    wingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissrdgedfkrps
    svsgsipsinvsgsqdnnttnrsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwkC (C:)
    qdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldykrl
    fgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddifq
    vylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedr
    kntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdseynsyvnfvkse
    lmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdqqvgatildskt
    gglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatnhaiqdessyqv
    dgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkfaaklglnyegd
    igpsevlggsasefsptqlasafaaianggtynnahsiqkvvtrdgetieydhtshkams
    dytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqynlpdnaakdvwi
    ngftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissrdgedfkrpssv
    sgsipsinvsgsqdnnttnrsth
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dwkD (D:)
    mlqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldyk
    rlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddi
    fqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaae
    drkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdseynsyvnfvk
    selmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdqqvgatilds
    ktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatnhaiqdessy
    qvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkfaaklglnye
    gdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvtrdgetieydhtshka
    msdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqynlpdnaakdv
    wingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissrdgedfkrps
    svsgsipsinvsgsqdnnttnrsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwkD (D:)
    ipakiydkngelvktldrhehvnlkdvpksmkdavlatednrfyehgaldykrlfastlt
    qqvvkdaflsqhksigrkaqeaylsyrleqeyskddifqvylnkiyysdgvtgikaaaky
    yfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedrkntvlylmhyhkritdkqwed
    akkidlkanlvnrtpeerqnidtnqdseynsyvnfvkselmnnkafkdenlgnvlqsgik
    iytnmdkdvqktlqndvdngsfyknkdqqvgatildsktgglvaisggrdfkdvvnrnqa
    tdphptgsslkpflaygpaienmkwatnhaiqdessyqvdgstfrnydtkshgtvsiyda
    lrqsfnipalkawqsvkqnagndapkkfaaklglnyegdigpsevlggsasefsptqlas
    afaaianggtynnahsiqkvvtrdgetieydhtshkamsdytaymlaemlkgtfkpygsa
    yghgvsgvnmgaktgtgtygaetysqynlpdnaakdvwingftpqytmsvwmgfskvkqy
    gensfvghsqqeypqflyenvmskissrdgedfkrpssvsgsipsinvsgsqdnnttnrs
    th