PDB entry 3dwf

View 3dwf on RCSB PDB site
Description: Crystal Structure of the Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Mutant F278E
Class: oxidoreductase
Keywords: Rossmann Fold, short chain dehydrogenase reductase, SDR, Endoplasmic reticulum, Glycoprotein, Lipid metabolism, Membrane, NADP, Oxidoreductase, Signal-anchor, Steroid metabolism, Transmembrane
Deposited on 2008-07-22, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 11-beta-hydroxysteroid dehydrogenase 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QLL4 (Start-275)
      • engineered (254)
    Domains in SCOPe 2.07: d3dwfa1
  • Chain 'B':
    Compound: 11-beta-hydroxysteroid dehydrogenase 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QLL4 (Start-275)
      • engineered (254)
    Domains in SCOPe 2.07: d3dwfb_
  • Chain 'C':
    Compound: 11-beta-hydroxysteroid dehydrogenase 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QLL4 (0-275)
      • engineered (254)
    Domains in SCOPe 2.07: d3dwfc1
  • Chain 'D':
    Compound: 11-beta-hydroxysteroid dehydrogenase 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QLL4 (Start-275)
      • engineered (254)
    Domains in SCOPe 2.07: d3dwfd_
  • Heterogens: NAP, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dwfA (A:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeelsaaeynwdnvlsneklygrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwfA (A:)
    ekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaa
    sahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnf
    hsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvn
    kvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwv
    pyllgnpgrkimeelsaaeynwdnvlsnerw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dwfB (B:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeelsaaeynwdnvlsneklygrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwfB (B:)
    ekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaa
    sahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnf
    hsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvn
    kvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwv
    pyllgnpgrkimeelsaaeynwdnvlsneklygrw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dwfC (C:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeelsaaeynwdnvlsneklygrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwfC (C:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeelsaaeynwdnvlsneklrw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dwfD (D:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeelsaaeynwdnvlsneklygrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwfD (D:)
    ekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaa
    sahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnf
    hsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvn
    kvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwv
    pyllgnpgrkimeelsaaeynwdnvlsneklygrw