PDB entry 3dwe

View 3dwe on RCSB PDB site
Description: Proteinase K by Classical hanging drop method after high X-Ray dose on ESRF ID14-2 beamline
Class: hydrolase
Keywords: Alpha and beta proteins, HYDROLASE, Calcium, Metal-binding, Protease, Serine protease, Zymogen
Deposited on 2008-07-22, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.221
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Proteinase K
    Species: Tritirachium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dwex_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dweX (X:)
    aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
    yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
    rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
    gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
    gkttaasacryiadtankgdlsnipfgtvnllaynnyqa