PDB entry 3dvu

View 3dvu on RCSB PDB site
Description: Crystal structure of the complex of murine gamma-herpesvirus 68 Bcl-2 homolog M11 and the Beclin 1 BH3 domain
Class: Viral Protein/apoptosis
Keywords: AUTOPHAGY, PROTEIN-PROTEIN COMPLEX, VIRAL BCL-2, BECLIN 1, APOPTOSIS, M11, ANTIVIRAL DEFENSE, BH3 DOMAIN, Coiled coil, Cytoplasm, Golgi apparatus, Membrane, Polymorphism, Viral Protein-apoptosis COMPLEX
Deposited on 2008-07-20, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-bcl-2
    Species: Murid herpesvirus 4 [TaxId:33708]
    Gene: v-bcl-2, GAMMAHV.M11, M11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dvua_
  • Chain 'B':
    Compound: V-bcl-2
    Species: Murid herpesvirus 4 [TaxId:33708]
    Gene: v-bcl-2, GAMMAHV.M11, M11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dvub_
  • Chain 'C':
    Compound: Beclin-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Beclin-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dvuA (A:)
    mashkksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyrad
    ygpalknwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcm
    thffiennlmnhfpledhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvuA (A:)
    ksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpal
    knwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffi
    ennlmnhfpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dvuB (B:)
    mashkksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyrad
    ygpalknwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcm
    thffiennlmnhfpledhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvuB (B:)
    ksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpal
    knwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffi
    ennlmnhfple
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.