PDB entry 3dvt

View 3dvt on RCSB PDB site
Description: Biochemical and structural characterization of the PAK1- LC8 interaction
Class: motor protein
Keywords: Dynein, LC8, light chain, PIN, dlc1, DYNLL1, Microtubule, Motor protein
Deposited on 2008-07-20, released 2009-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dvta_
  • Chain 'B':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dvtb_
  • Chain 'C':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dvtc_
  • Chain 'D':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dvtd_
  • Chain 'E':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dvte_
  • Chain 'F':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dvtf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dvtA (A:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvtA (A:)
    kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dvtB (B:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvtB (B:)
    kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dvtC (C:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvtC (C:)
    kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dvtD (D:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvtD (D:)
    kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3dvtE (E:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvtE (E:)
    rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
    syvthetrhfiyfylgqvaillfksg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3dvtF (F:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvtF (F:)
    rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
    syvthetrhfiyfylgqvaillfksg