PDB entry 3dvp

View 3dvp on RCSB PDB site
Description: Pak1 peptide bound LC8
Class: structural protein, motor protein
Keywords: Pak1, LC8, DLC1, PIN, Complex, Dynein, Microtubule, Motor protein, STRUCTURAL PROTEIN
Deposited on 2008-07-18, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24117 (Start-90)
      • engineered (37)
    Domains in SCOPe 2.07: d3dvpa_
  • Chain 'B':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24117 (Start-90)
      • engineered (37)
    Domains in SCOPe 2.07: d3dvpb_
  • Chain 'C':
    Compound: P21 activated Kinase peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: P21 activated Kinase peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dvpA (A:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvpA (A:)
    kaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dvpB (B:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvpB (B:)
    kaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.