PDB entry 3dvh

View 3dvh on RCSB PDB site
Description: LC8 Point mutant K36P
Class: motor protein
Keywords: Dynein, DLC1, light chain, PIN, LC8, Cytoplasm, Microtubule, Motor protein
Deposited on 2008-07-18, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-01-20, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24117 (Start-90)
      • engineered (37)
    Domains in SCOPe 2.07: d3dvha_
  • Chain 'B':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24117 (Start-90)
      • engineered (37)
    Domains in SCOPe 2.07: d3dvhb_
  • Chain 'C':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24117 (Start-90)
      • engineered (37)
    Domains in SCOPe 2.07: d3dvhc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dvhA (A:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvhA (A:)
    kaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dvhB (B:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvhB (B:)
    kaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dvhC (C:)
    mdmsdrkaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhciv
    grnfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dvhC (C:)
    kaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhcivgrnfgs
    yvthetrhfiyfylgqvaillfksg