PDB entry 3dvf

View 3dvf on RCSB PDB site
Description: Structure of amyloidogenic kappa 1 Bence Jones protein
Class: protein fibril
Keywords: AL, light chain amyloidosis, amyloid, immunoglobulin, light chain, light chain variable domain, PROTEIN FIBRIL
Deposited on 2008-07-18, released 2009-05-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-12
    Species: Homo sapiens [TaxId:9606]
    Gene: mutant of Vk1 O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3DVF (0-106)
    Domains in SCOPe 2.04: d3dvfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dvfA (A:)
    diqmtqspsslsasvgdrvtitcqasqditnhlnwyqqkpgkapklliydasnletgvps
    rfsgrgsgthftftisslqpadiatyycqeydylpqtfgggtkveik