PDB entry 3dv9

View 3dv9 on RCSB PDB site
Description: Putative beta-phosphoglucomutase from Bacteroides vulgatus.
Class: isomerase
Keywords: structural genomics, APC60149, beta-phosphoglucomutase, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, ISOMERASE
Deposited on 2008-07-18, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.171
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: Bacteroides vulgatus [TaxId:435590]
    Gene: BVU_4110
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6L7P8 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3dv9a1, d3dv9a2
  • Heterogens: MG, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dv9A (A:)
    snamfkeainnylhthgyesidlkavlfdmdgvlfdsmpnhaeswhkimkrfgfglsree
    aymhegrtgastinivsrrerghdateeeikaiyqakteefnkcpkaermpgalevltki
    ksegltpmvvtgsgqtslldrlnhnfpgifqanlmvtafdvkygkpnpepylmalkkggf
    kpnealvienaplgvqagvaagiftiavntgplhdnvllneganllfhsmpdfnknwetl
    qsalkqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dv9A (A:)
    snamfkeainnylhthgyesidlkavlfdmdgvlfdsmpnhaeswhkimkrfgfglsree
    aymhegrtgastinivsrrerghdateeeikaiyqakteefnkcpkaermpgalevltki
    ksegltpmvvtgsglldrlnhnfpgifqanlmvtafdvkygkpnpepylmalkkggfkpn
    ealvienaplgvqagvaagiftiavntgplhdnvllneganllfhsmpdfnknwetlqsa
    lkq