PDB entry 3dtp

View 3dtp on RCSB PDB site
Description: Tarantula heavy meromyosin obtained by flexible docking to Tarantula muscle thick filament Cryo-EM 3D-MAP
Class: contractile protein
Keywords: muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain, regulatory light chain, motor protein, coiled-coil, contractile protein
Deposited on 2008-07-15, released 2008-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: EM
Resolution: 20 Å
R-factor: N/A
AEROSPACI score: -0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-11,Myosin-7
    Species: Homo sapiens [TaxId:9606]
    Gene: MYH7, MYHCB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10587 (1-850)
      • see sequence_details (0)
    • Uniprot P12883 (851-970)
  • Chain 'B':
    Compound: Myosin-11,Myosin-7
    Species: Homo sapiens [TaxId:9606]
    Gene: MYH7, MYHCB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10587 (1-850)
      • see sequence_details (0)
    • Uniprot P12883 (851-972)
  • Chain 'C':
    Compound: Myosin light polypeptide 6
    Species: Gallus gallus [TaxId:9031]
    Gene: MYL6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dtpc1
  • Chain 'D':
    Compound: Myosin light polypeptide 6
    Species: Gallus gallus [TaxId:9031]
    Gene: MYL6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dtpd1
  • Chain 'E':
    Compound: Myosin II regulatory light chain
    Species: Avicularia avicularia [TaxId:479442]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Myosin II regulatory light chain
    Species: Avicularia avicularia [TaxId:479442]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3dtpC (C:)
cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
eeeveqlvaghedsngcinyeelvrmvlsg

    Sequence, based on observed residues (ATOM records): (download) 
    >3dtpC (C:)
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >3dtpD (D:)
cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
eeeveqlvaghedsngcinyeelvrmvlsg

    Sequence, based on observed residues (ATOM records): (download) 
    >3dtpD (D:)
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.