PDB entry 3dt3

View 3dt3 on RCSB PDB site
Description: Human Estrogen receptor alpha LBD with GW368
Class: transcription
Keywords: estrogen receptor, nuclear receptor, SERM, transcription factor, alpha-helical sandwich, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc-finger
Deposited on 2008-07-14, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dt3a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dt3b_
  • Heterogens: 369, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dt3A (A:)
    gskrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpl
    ydlllemldahrlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dt3A (A:)
    lalsltadqmvsalldaeppilyseseasmmglltnladrelvhminwakrvpgfvdltl
    hdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvytfsstlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmknvvplydlllemldahrlha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dt3B (B:)
    gskrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvh
    minwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgk
    cvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhih
    rvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpl
    ydlllemldahrlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dt3B (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtli
    hlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcnvvplydlllemldahr