PDB entry 3dt1

View 3dt1 on RCSB PDB site
Description: P38 Complexed with a quinazoline inhibitor
Class: transferase
Keywords: Kinase Inhibitor complex, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2008-07-14, released 2008-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (23-End)
      • expression tag (19-22)
    Domains in SCOPe 2.06: d3dt1a2, d3dt1a3
  • Heterogens: P40, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dt1A (A:)
    mgsshhhhhhssglvprgshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygs
    vcaafdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsle
    efndvylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnla
    vnedcelkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaell
    tgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiga
    nplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidew
    ksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dt1A (A:)
    hmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkls
    rpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnni
    vkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtd
    demtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklil
    rlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkr
    itaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp