PDB entry 3dsv

View 3dsv on RCSB PDB site
Description: Crystal structure of RabGGTase(DELTA LRR; DELTA IG)in complex with mono-prenylated peptide Ser-Cys-Ser-Cys(GG) derivated from Rab7
Class: transferase
Keywords: protein prenylation, Metal-binding, Prenyltransferase, Transferase, Zinc, Phosphoprotein
Deposited on 2008-07-14, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl transferase type-2 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rabggta, Ggta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08602 (1-237)
      • linker (238-241)
    • Uniprot Q08602 (242-End)
  • Chain 'B':
    Compound: Geranylgeranyl transferase type-2 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rabggtb, Ggtb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dsvb_
  • Heterogens: ZN, CA, GER, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dsvB (B:)
    mgtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlm
    gqlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvv
    ayvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdgg
    fgcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvc
    yswwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsl
    lgeeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsvB (B:)
    qkdvtiksdapdtlllekhadyiasygsdyeycmseylrmsgvywgltvmdlmgqlhrmn
    keeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslq
    kedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgs
    eshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvla
    slkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqik
    pvspvfcmpeevlqrvnvqpelvs