PDB entry 3dsn

View 3dsn on RCSB PDB site
Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Thr7Phe mutation in the Gd donor strand
Class: chaperone
Keywords: CHAPERONE, FIMBRIAL SUBUNIT, FIMBRIAE, DONOR STRAND COMPLEMENTATION, PROTEIN-PROTEIN COMPLEX, BETA BARREL, Immunoglobulin domain, Periplasm, Plasmid, Capsule, Secreted
Deposited on 2008-07-13, released 2009-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.237
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M, YPMT1.82, y5194, y1098, YP_pMT084
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dsna1, d3dsna2
  • Chain 'B':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26948 (12-148)
      • insertion (0-11)
    Domains in SCOPe 2.06: d3dsnb_
  • Chain 'C':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dsnc_
  • Chain 'D':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M, YPMT1.82, y5194, y1098, YP_pMT084
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dsnd1, d3dsnd2
  • Chain 'E':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26948 (12-148)
      • insertion (0-11)
    Domains in SCOPe 2.06: d3dsne_
  • Chain 'F':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dsnf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dsnA (A:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsnA (A:)
    skeygvtigesriiypldaagvmvsvkntqdypvliqsriydedpfvvtpplfrldakqq
    nslriaqaggvfprdkeslkwlcvkgippkgvfvqfainncikllvrpnelkgtpiqfae
    nlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkglagarnvsw
    riindqggldrlysknvtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dsnB (B:)
    adltasftatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsnB (B:)
    adltasftatatlveparitltykegapitimngnidtellvgtltlggyktgttstsvn
    ftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdf
    fvrsigskggklakytdavtvtvsnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dsnC (C:)
    adltasftatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsnC (C:)
    ritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsq
    dgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagk
    ytdavtvtvsnq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dsnD (D:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsnD (D:)
    skeygvtigesriiypldaagvmvsvkntqdypvliqsriyddpfvvtpplfrldakqqn
    slriaqaggvfprdkeslkwlcvkgippkdvgvfvqfainncikllvrpnelkgtpiqfa
    enlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlnvswriindqg
    gldrlysknv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dsnE (E:)
    adltasftatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3dsnF (F:)
    adltasftatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsnF (F:)
    itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
    gnnhqfttkvigkdsrdfdispkvngengddvvlatgsqdffvrsigskggklaagkytd
    avtvtvsnq