PDB entry 3dsd

View 3dsd on RCSB PDB site
Description: Crystal structure of P. furiosus Mre11-H85S bound to a branched DNA and manganese
Class: Hydrolase/DNA
Keywords: Protein-DNA complex, Double Helix, Nuclease, DNA damage, DNA repair, Endonuclease, Exonuclease, Hydrolase, Manganese, Metal-binding, Hydrolase/DNA COMPLEX
Deposited on 2008-07-11, released 2008-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA double-strand break repair protein mre11
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: mre11, PF1166
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1N9 (0-End)
      • engineered (84)
    Domains in SCOPe 2.05: d3dsda_
  • Chain 'B':
    Compound: DNA double-strand break repair protein mre11
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: mre11, PF1166
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1N9 (0-End)
      • engineered (84)
    Domains in SCOPe 2.05: d3dsdb_
  • Chain 'C':
    Compound: DNA (5'-d(*dcp*dgp*dcp*dgp*dcp*dap*dcp*dap*dap*dgp*dcp*dtp*dtp*dtp*dtp*dgp*dcp*dtp*dtp*dgp*dtp*dgp*dgp*dap*dtp*da)-3')
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dsdA (A:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnsdrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwrikertdeesgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsdA (A:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnsdrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dsdB (B:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnsdrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwrikertdeesgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsdB (B:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnsdrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwri
    

  • Chain 'C':
    No sequence available.