PDB entry 3dsc

View 3dsc on RCSB PDB site
Description: Crystal structure of P. furiosus Mre11 DNA synaptic complex
Class: Hydrolase/DNA
Keywords: Protein-DNA complex, Double Helix, Nuclease, DNA damage, DNA repair, Endonuclease, Exonuclease, Hydrolase, Manganese, Metal-binding, Hydrolase-DNA COMPLEX
Deposited on 2008-07-11, released 2008-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA double-strand break repair protein mre11
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: mre11, PF1166
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dsca_
  • Chain 'B':
    Compound: DNA (5'-d(p*dcp*dap*dcp*dap*dap*dgp*dcp*dtp*dtp*dtp*dtp*dgp*dcp*dtp*dtp*dgp*dtp*dgp*dap*dc)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dscA (A:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwrikertdeesgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dscA (A:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwri
    

  • Chain 'B':
    No sequence available.