PDB entry 3ds0

View 3ds0 on RCSB PDB site
Description: hiv-1 capsid c-terminal domain mutant (n183a) in complex with an inhibitor of particle assembly (cai)
Deposited on 2008-07-11, released 2008-09-02
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11698]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-85)
      • engineered mutation (37)
  • Chain 'T':
    Compound: Peptide inhibitor of capsid assembly
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DS0 (0-11)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ds0A (A:)
sptsildirqgpkepfrdyvdrfyktlraeqasqevkawmtetllvqnanpdcktilkal
gpgatleemmtacqgvggpghkarvl

    Sequence, based on observed residues (ATOM records):
    >3ds0A (A:)
ptsildirqgpkepfrdyvdrfyktlraeqasqevkawmtetllvqnanpdcktilkalg
pgatleemmtacqgvggpghka

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >3ds0T (T:)
itfedlldyygp