PDB entry 3drm

View 3drm on RCSB PDB site
Description: 2.2 Angstrom Crystal Structure of Thr114Phe Alpha1-Antitrypsin
Class: Hydrolase inhibitor
Keywords: serpin, serine proteinase inhibitor, alpha1-antitrypsin, polymerisation, rational drug design, conformational disease, emphysema, cirrhosis, Acute phase, Alternative splicing, Blood coagulation, Disease mutation, Glycoprotein, Hydrolase, Polymorphism, Protease, Protease inhibitor, Secreted, Serine protease inhibitor, Hydrolase inhibitor
Deposited on 2008-07-11, released 2009-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA1, AAT, PI, PRO0684, PRO2209
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01009
      • engineered (123)
    Domains in SCOPe 2.07: d3drma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3drmA (A:)
    mrgshhhhhhtdpqgdaaqktdtshhdqdhptfnkitpnlaefafslyrqlahqsnstni
    ffspvsiatafamlslgtkadthdeileglnfnlteipeaqihegfqellrtlnqpdsql
    qltfgnglflseglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkiv
    dlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniq
    hckklsswvllmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpk
    lsitgtydlksvlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaaga
    mfleaipmsippevkfnkpfvflmieqntksplfmgkvvnptqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3drmA (A:)
    nkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfn
    lteipeaqihegfqellrtlnqpdsqlqltfgnglflseglklvdkfledvkklyhseaf
    tvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdt
    eeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhl
    enelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvte
    eaplklskavhkavltidekfleaipmsippevkfnkpfvflmieqntksplfmgkvvnp
    tq