PDB entry 3dre

View 3dre on RCSB PDB site
Description: Crystal structure of Human Brain-type Creatine Kinase
Class: transferase
Keywords: human, creatine kinase, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Phosphoprotein, Polymorphism, Transferase
Deposited on 2008-07-11, released 2009-03-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Creatine kinase B-type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3drea1, d3drea2
  • Chain 'B':
    Compound: Creatine kinase B-type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dreb1, d3dreb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dreA (A:)
    mpfsnshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtg
    vdnpghpyimtvgcvagdeesyevfkdlfdpiiedrhggykpsdehktdlnpdnlqggdd
    ldpnyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmt
    eaeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwvneedhlrvism
    qkggnmkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklp
    nlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvkll
    iemeqrleqgqaiddlmpaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dreA (A:)
    snshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdn
    pghpyimtvgcvagdeesyevfkdlfdpiiedrhggykpsdehktdlnpdnlqggddldp
    nyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmteae
    qqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwvneedhlrvismqkg
    gnmkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklpnlg
    khekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklliem
    eqrleqgqaiddlmpaqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dreB (B:)
    mpfsnshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtg
    vdnpghpyimtvgcvagdeesyevfkdlfdpiiedrhggykpsdehktdlnpdnlqggdd
    ldpnyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmt
    eaeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwvneedhlrvism
    qkggnmkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklp
    nlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvkll
    iemeqrleqgqaiddlmpaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dreB (B:)
    nshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdnp
    ghpyimtvgcvagdeesyevfkdlfdpiiedrhggykpsdehktdlnpdnlqggddldpn
    yvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmteaeq
    qqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwvneedhlrvismqkgg
    nmkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklpnlgk
    hekfsevlkrlrlqkrvggvfdvsnadrlgfsevelvqmvvdgvklliemeqrleqgqai
    ddlmpaqk