PDB entry 3dr7

View 3dr7 on RCSB PDB site
Description: GDP-perosamine synthase from Caulobacter crescentus with bound GDP-3-deoxyperosamine
Class: transferase
Keywords: perosamine, pyridoxal phosphate, o-antigen, lipopolysaccharide, aspartate aminotransferase, deoxysugar
Deposited on 2008-07-10, released 2008-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative perosamine synthetase
    Species: Caulobacter crescentus
    Gene: Per
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85354 (45-390)
      • expression tag (23-44)
    Domains in SCOPe 2.03: d3dr7a_
  • Chain 'B':
    Compound: Putative perosamine synthetase
    Species: Caulobacter crescentus
    Gene: Per
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85354 (45-390)
      • expression tag (24-44)
    Domains in SCOPe 2.03: d3dr7b_
  • Chain 'C':
    Compound: Putative perosamine synthetase
    Species: Caulobacter crescentus
    Gene: Per
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85354 (45-390)
      • expression tag (24-44)
    Domains in SCOPe 2.03: d3dr7c_
  • Chain 'D':
    Compound: Putative perosamine synthetase
    Species: Caulobacter crescentus
    Gene: Per
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85354 (45-390)
      • expression tag (24-44)
    Domains in SCOPe 2.03: d3dr7d_
  • Heterogens: GPD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dr7A (A:)
    mgsshhhhhhssenlyfqghmsdlprisvaaprldgnerdyvlecmdttwissvgrfive
    fekafadycgvkhaiacnngttalhlalvamgigpgdevivpsltyiasansvtycgatp
    vlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpilevarrhnllviedaae
    avgatyrgkksgslgdcatfsffgnkiittgeggmittndddlaakmrllrgqgmdpnrr
    ywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqklarlgnrvtkphvalt
    grhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimppyahlatddlkiaea
    cgvdglnlpthaglteadidrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dr7A (A:)
    lprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngtta
    lhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitp
    rtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsff
    gnkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaq
    lervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqv
    ikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvi
    aaldqvlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dr7B (B:)
    mgsshhhhhhssenlyfqghmsdlprisvaaprldgnerdyvlecmdttwissvgrfive
    fekafadycgvkhaiacnngttalhlalvamgigpgdevivpsltyiasansvtycgatp
    vlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpilevarrhnllviedaae
    avgatyrgkksgslgdcatfsffgnkiittgeggmittndddlaakmrllrgqgmdpnrr
    ywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqklarlgnrvtkphvalt
    grhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimppyahlatddlkiaea
    cgvdglnlpthaglteadidrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dr7B (B:)
    prisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttal
    hlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitpr
    tkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffg
    nkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaql
    ervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvi
    kdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvia
    aldqvlv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dr7C (C:)
    mgsshhhhhhssenlyfqghmsdlprisvaaprldgnerdyvlecmdttwissvgrfive
    fekafadycgvkhaiacnngttalhlalvamgigpgdevivpsltyiasansvtycgatp
    vlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpilevarrhnllviedaae
    avgatyrgkksgslgdcatfsffgnkiittgeggmittndddlaakmrllrgqgmdpnrr
    ywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqklarlgnrvtkphvalt
    grhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimppyahlatddlkiaea
    cgvdglnlpthaglteadidrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dr7C (C:)
    prisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttal
    hlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitpr
    tkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffg
    nkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaql
    ervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvi
    kdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvia
    aldqvlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dr7D (D:)
    mgsshhhhhhssenlyfqghmsdlprisvaaprldgnerdyvlecmdttwissvgrfive
    fekafadycgvkhaiacnngttalhlalvamgigpgdevivpsltyiasansvtycgatp
    vlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpilevarrhnllviedaae
    avgatyrgkksgslgdcatfsffgnkiittgeggmittndddlaakmrllrgqgmdpnrr
    ywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqklarlgnrvtkphvalt
    grhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimppyahlatddlkiaea
    cgvdglnlpthaglteadidrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dr7D (D:)
    prisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttal
    hlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitpr
    tkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffg
    nkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaql
    ervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvi
    kdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvia
    aldqvlv