PDB entry 3dr4

View 3dr4 on RCSB PDB site
Description: GDP-perosamine synthase K186A mutant from Caulobacter crescentus with bound sugar ligand
Class: transferase
Keywords: Perosamine, deoxysugar, pyridoxal phosphate, aspartate aminotransferase, o-antigen
Deposited on 2008-07-10, released 2008-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.166
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative perosamine synthetase
    Species: Caulobacter crescentus
    Gene: Per
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85354 (45-390)
      • expression tag (27-44)
      • engineered (205)
    Domains in SCOPe 2.03: d3dr4a_
  • Chain 'B':
    Compound: Putative perosamine synthetase
    Species: Caulobacter crescentus
    Gene: Per
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85354 (45-390)
      • expression tag (25-44)
      • engineered (205)
    Domains in SCOPe 2.03: d3dr4b_
  • Chain 'C':
    Compound: Putative perosamine synthetase
    Species: Caulobacter crescentus
    Gene: Per
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85354 (45-390)
      • expression tag (23-44)
      • engineered (205)
    Domains in SCOPe 2.03: d3dr4c_
  • Chain 'D':
    Compound: Putative perosamine synthetase
    Species: Caulobacter crescentus
    Gene: Per
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85354 (45-390)
      • expression tag (24-44)
      • engineered (205)
    Domains in SCOPe 2.03: d3dr4d_
  • Heterogens: G4M, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dr4A (A:)
    mgsshhhhhhssenlyfqghmsdlprisvaaprldgnerdyvlecmdttwissvgrfive
    fekafadycgvkhaiacnngttalhlalvamgigpgdevivpsltyiasansvtycgatp
    vlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpilevarrhnllviedaae
    avgatyrgkksgslgdcatfsffgnaiittgeggmittndddlaakmrllrgqgmdpnrr
    ywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqklarlgnrvtkphvalt
    grhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimppyahlatddlkiaea
    cgvdglnlpthaglteadidrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dr4A (A:)
    svaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttalhla
    lvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitprtka
    impvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffgnai
    ittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaqlerv
    dehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvikdl
    dalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrviaald
    qvlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dr4B (B:)
    mgsshhhhhhssenlyfqghmsdlprisvaaprldgnerdyvlecmdttwissvgrfive
    fekafadycgvkhaiacnngttalhlalvamgigpgdevivpsltyiasansvtycgatp
    vlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpilevarrhnllviedaae
    avgatyrgkksgslgdcatfsffgnaiittgeggmittndddlaakmrllrgqgmdpnrr
    ywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqklarlgnrvtkphvalt
    grhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimppyahlatddlkiaea
    cgvdglnlpthaglteadidrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dr4B (B:)
    risvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttalh
    lalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitprt
    kaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffgn
    aiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaqle
    rvdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvik
    dldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrviaa
    ldqvlv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dr4C (C:)
    mgsshhhhhhssenlyfqghmsdlprisvaaprldgnerdyvlecmdttwissvgrfive
    fekafadycgvkhaiacnngttalhlalvamgigpgdevivpsltyiasansvtycgatp
    vlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpilevarrhnllviedaae
    avgatyrgkksgslgdcatfsffgnaiittgeggmittndddlaakmrllrgqgmdpnrr
    ywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqklarlgnrvtkphvalt
    grhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimppyahlatddlkiaea
    cgvdglnlpthaglteadidrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dr4C (C:)
    lprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngtta
    lhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitp
    rtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsff
    gnaiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaq
    lervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqv
    ikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvi
    aaldqvlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dr4D (D:)
    mgsshhhhhhssenlyfqghmsdlprisvaaprldgnerdyvlecmdttwissvgrfive
    fekafadycgvkhaiacnngttalhlalvamgigpgdevivpsltyiasansvtycgatp
    vlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpilevarrhnllviedaae
    avgatyrgkksgslgdcatfsffgnaiittgeggmittndddlaakmrllrgqgmdpnrr
    ywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqklarlgnrvtkphvalt
    grhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimppyahlatddlkiaea
    cgvdglnlpthaglteadidrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dr4D (D:)
    prisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttal
    hlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitpr
    tkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffg
    naiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaql
    ervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvi
    kdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvia
    aldqvlv