PDB entry 3dr0

View 3dr0 on RCSB PDB site
Description: Structure of reduced cytochrome c6 from Synechococcus sp. PCC 7002
Deposited on 2008-07-10, released 2009-07-14
The last revision was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.108
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Synechococcus sp. PCC 7002 [TaxId:32049]
    Gene: petJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cytochrome c6
    Species: Synechococcus sp. PCC 7002 [TaxId:32049]
    Gene: petJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cytochrome c6
    Species: Synechococcus sp. PCC 7002 [TaxId:32049]
    Gene: petJ
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3dr0A (A:)
adaaagaqvfaancaachaggnnavmptktlkadalktylagykdgsksleeavayqvtn
gqgampafggrlsdadianvaayiadqaennkw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3dr0B (B:)
adaaagaqvfaancaachaggnnavmptktlkadalktylagykdgsksleeavayqvtn
gqgampafggrlsdadianvaayiadqaennkw

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3dr0C (C:)
adaaagaqvfaancaachaggnnavmptktlkadalktylagykdgsksleeavayqvtn
gqgampafggrlsdadianvaayiadqaennkw