PDB entry 3dqz

View 3dqz on RCSB PDB site
Description: Structure of the hydroxynitrile lyase from Arabidopsis thaliana
Class: lyase
Keywords: A/B-Hydrloase fold, Cyanogenesis, Lyase
Deposited on 2008-07-10, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-hydroxynitrile lyase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: F18D22_70, At5g10300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dqza_
  • Chain 'B':
    Compound: Alpha-hydroxynitrile lyase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: F18D22_70, At5g10300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dqzb_
  • Chain 'C':
    Compound: Alpha-hydroxynitrile lyase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: F18D22_70, At5g10300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dqzc_
  • Chain 'D':
    Compound: Alpha-hydroxynitrile lyase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: F18D22_70, At5g10300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dqzd_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dqzA (A:)
    merkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
    plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
    kymempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
    tedlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvml
    skpqklfdslsaiatdym
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dqzA (A:)
    rkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeyskpl
    ietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvldky
    mempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsffte
    dlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvmlsk
    pqklfdslsaiatdym
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dqzB (B:)
    merkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
    plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
    kymempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
    tedlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvml
    skpqklfdslsaiatdym
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dqzB (B:)
    rkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeyskpl
    ietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvldky
    mempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsffte
    dlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvmlsk
    pqklfdslsaiatdy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dqzC (C:)
    merkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
    plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
    kymempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
    tedlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvml
    skpqklfdslsaiatdym
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dqzC (C:)
    rkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeyskpl
    ietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvldky
    mempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsffte
    dlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvmlsk
    pqklfdslsaiatdym
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dqzD (D:)
    merkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
    plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
    kymempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
    tedlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvml
    skpqklfdslsaiatdym
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dqzD (D:)
    rkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeyskpl
    ietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvldky
    mempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsffte
    dlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvmlsk
    pqklfdslsaiatdy