PDB entry 3dqp

View 3dqp on RCSB PDB site
Description: crystal structure of the oxidoreductase ylbe from lactococcus lactis, northeast structural genomics consortium target kr121.
Deposited on 2008-07-09, released 2008-09-09
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase ylbE
    Species: Lactococcus lactis subsp. lactis [TaxId:1360]
    Gene: ylbE, LL1109, L119, L119013
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CGI7 (0-210)
      • engineered mutation (63)
      • expression tag (211-218)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3dqpA (A:)
mkifivgstgrvgksllkslsttdyqiyagarkveqvpqynnvkavhfdvdwtpeemakq
lhgmdaiinvsgsggksllkvdlygavklmqaaekaevkrfillstifslqpekwigagf
dalkdyyiakhfadlyltketnldytiiqpgalteeeatglidindevsasntigdvadt
ikelvmtdhsigkvismhngktaikealesllehhhhhh