PDB entry 3dq4

View 3dq4 on RCSB PDB site
Description: Structure of the Yellow Fluorescent Protein Citrine Frozen at 2000 Atmospheres Number 2: Structure 20 in a Series of 26 High Pressure Structures
Class: luminescent protein
Keywords: Yellow Fluorescent Protein, beta barrel, chromophore, fluorescent protein, high pressure, Luminescence, Photoprotein, LUMINESCENT PROTEIN
Deposited on 2008-07-09, released 2008-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.198
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (6-End)
      • expression tag (2-5)
      • chromophore (70)
      • engineered (72-73)
      • engineered (76)
      • engineered (207)
    Domains in SCOPe 2.06: d3dq4a1, d3dq4a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dq4A (A:)
    gddpmvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpv
    pwptlvttfgyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfe
    gdtlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgs
    vqladhyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmde
    lyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dq4A (A:)
    dpmvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpw
    ptlvttfgyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegd
    tlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvq
    ladhyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit