PDB entry 3dpy

View 3dpy on RCSB PDB site
Description: Protein farnesyltransferase complexed with FPP and caged TKCVIM substrate
Class: transferase
Keywords: farnesyltransferase, FTase, PFT, geranylgeranyltransferase, prenylation, protein prenylation, protein prenyltransferase, prenyltransferase, FPP, Transferase, Metal-binding, Phosphoprotein
Deposited on 2008-07-09, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dpya1
  • Chain 'B':
    Compound: Protein farnesyltransferase subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fntb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dpyb1
  • Chain 'C':
    Compound: caged substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DPY (Start-5)
  • Heterogens: ZN, FPP, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dpyA (A:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dpyA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhsresdipasv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dpyB (B:)
    massssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpv
    pgfeecedavtsdpatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dpyB (B:)
    pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
    khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
    dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
    gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
    aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
    aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
    gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
    

  • Chain 'C':
    No sequence available.