PDB entry 3dpl
View 3dpl on RCSB PDB site
Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation.
Class: ligase
Keywords: ubiquitin, NEDD8, cullin, Host-virus interaction, Receptor, Ubl conjugation, Ubl conjugation pathway, Acetylation, Cytoplasm, DNA damage, DNA repair, Metal-binding, Nucleus, Zinc, Zinc-finger, LIGASE
Deposited on
2008-07-08, released
2008-09-30
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'C':
Compound: Cullin-5
Species: Homo sapiens [TaxId:9606]
Gene: CUL5, VACM1
Database cross-references and differences (RAF-indexed):
- Uniprot Q93034 (2-381)
- engineered (8)
- engineered (40-41)
- Chain 'R':
Compound: RING-box protein 1
Species: Homo sapiens [TaxId:9606]
Gene: RBX1, RNF75, ROC1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3dplr_ - Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'C':
No sequence available.
- Chain 'R':
Sequence, based on SEQRES records: (download)
>3dplR (R:)
gsmdvdtpsgtnsgagkkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqas
atseectvawgvcnhafhfhcisrwlktrqvcpldnrewefqkygh
Sequence, based on observed residues (ATOM records): (download)
>3dplR (R:)
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasaectvawgvcnhafhf
hcisrwlktrqvcpldnrewefqkygh