PDB entry 3dpl

View 3dpl on RCSB PDB site
Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation.
Class: ligase
Keywords: ubiquitin, NEDD8, cullin, Host-virus interaction, Receptor, Ubl conjugation, Ubl conjugation pathway, Acetylation, Cytoplasm, DNA damage, DNA repair, Metal-binding, Nucleus, Zinc, Zinc-finger, LIGASE
Deposited on 2008-07-08, released 2008-09-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Cullin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: CUL5, VACM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93034 (2-381)
      • engineered (8)
      • engineered (40-41)
  • Chain 'R':
    Compound: RING-box protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBX1, RNF75, ROC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dplr_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3dplR (R:)
    gsmdvdtpsgtnsgagkkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqas
    atseectvawgvcnhafhfhcisrwlktrqvcpldnrewefqkygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dplR (R:)
    kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasaectvawgvcnhafhf
    hcisrwlktrqvcpldnrewefqkygh