PDB entry 3dph

View 3dph on RCSB PDB site
Description: HIV-1 capsid C-terminal domain mutant (L211S)
Class: viral protein
Keywords: HIV, CAPSID, MUTANT, ASSEMBLY, POLYPROTEIN, VIRAL PROTEIN, Mainly Alpha, Capsid maturation, Capsid protein
Deposited on 2008-07-08, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497
      • engineered (65)
    Domains in SCOPe 2.07: d3dpha_
  • Chain 'B':
    Compound: hiv-1 capsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497
      • engineered (65)
    Domains in SCOPe 2.07: d3dphb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dphA (A:)
    sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
    gpgatseemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dphA (A:)
    ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
    pgatseemmtacqgvggp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dphB (B:)
    sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
    gpgatseemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dphB (B:)
    ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
    pgatseemmtacqgvggpgh