PDB entry 3dpc

View 3dpc on RCSB PDB site
Description: Structure of E.coli Alkaline Phosphatase Mutant in Complex with a Phosphorylated Peptide
Class: hydrolase
Keywords: alkaline phosphatase, complex structure, protein kinase, Hydrolase, Magnesium, Metal-binding, Phosphoprotein
Deposited on 2008-07-07, released 2009-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-448)
      • engineered (101)
      • expression tag (449)
    Domains in SCOPe 2.06: d3dpca1, d3dpca2
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-448)
      • engineered (101)
    Domains in SCOPe 2.06: d3dpcb_
  • Chain 'C':
    Compound: Phosphorylated Peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB PDB (0-9)
  • Heterogens: PO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dpcA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdlaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dpcA (A:)
    pempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaa
    rnyaegaggffkgidalpltgqythyalnkktgkpdyvtdlaasatawstgvktyngalg
    vdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgn
    alekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaa
    slnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaq
    mtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegn
    tlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaa
    ygphaanvvgltdqtdlfytmkaalglkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dpcB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdlaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dpcB (B:)
    pempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaa
    rnyaegaggffkgidalpltgqythyalnkktgkpdyvtdlaasatawstgvktyngalg
    vdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgn
    alekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaa
    slnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaq
    mtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegn
    tlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaa
    ygphaanvvgltdqtdlfytmkaalglk
    

  • Chain 'C':
    No sequence available.