PDB entry 3dpb

View 3dpb on RCSB PDB site
Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Ala9Val, Ala11Val, and Leu13Val mutations in the Gd donor strand
Class: chaperone/structural protein
Keywords: DONOR STRAND COMPLEMENTATION, FIMBRIAE, CHAPERONE, PROTEIN-PROTEIN COMPLEX, BETA BARREL, Immunoglobulin domain, Periplasm, Plasmid, Capsule, Secreted, CHAPERONE/STRUCTURAL PROTEIN COMPLEX
Deposited on 2008-07-07, released 2009-07-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M, YPMT1.82, y5194, y1098, YP_pMT084
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dpba1, d3dpba2
  • Chain 'B':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26948 (0-148)
      • engineered (8)
      • engineered (10)
      • engineered (12)
    Domains in SCOPe 2.05: d3dpbb_
  • Chain 'C':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dpbc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dpbA (A:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dpbA (A:)
    skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekpfvvtpplfrlda
    kqqnslriaqaggvfprdkeslkwlcvkgippdvgvfvqfainncikllvrpnelkgtpi
    qfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlarnvswri
    indqggldrlysknvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dpbB (B:)
    adltasttvtvtvveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dpbC (C:)
    adltasttvtvtvveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dpbC (C:)
    itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
    gnnhqfttkvigkdsrdfdispkvngenldvvlatgsqdffvrsigskggklaagkytda
    vtvtvsnq