PDB entry 3dp5

View 3dp5 on RCSB PDB site
Description: Crystal structure of Geobacter sulfurreducens OmcF with N-terminal Strep-tag II
Class: electron transport
Keywords: c-type cytochrome, Fe SAD phasing, dissimilatory metal reduction, Geobacter sulfurreducens, ELECTRON TRANSPORT
Deposited on 2008-07-07, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c family protein
  Species: Geobacter sulfurreducens [TaxId:35554]
  Gene: GSU2432
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q74AE4 (20-98)
    • expression tag (0-19)
  Domains in SCOPe 2.08: d3dp5a1, d3dp5a2
• Heterogens: SO4, HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3dp5A (A:)
  aaswshpqfekgaetavpnsgggelfathcagchpqggntvhpektlararreangirtv
  rdvaayirnpgpgmpafgeamippadalkigeyvvasfp