PDB entry 3dp3

View 3dp3 on RCSB PDB site
Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Helicobacter pylori in complex with compound 3q
Class: lyase
Keywords: FabZ complex, LYASE
Deposited on 2008-07-07, released 2009-05-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dp3a_
  • Chain 'B':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dp3b_
  • Chain 'C':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dp3c_
  • Chain 'D':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dp3d_
  • Chain 'E':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dp3e_
  • Chain 'F':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dp3f_
  • Heterogens: CL, BEN, 4BB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dp3A (A:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dp3A (A:)
    lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
    vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
    hkgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dp3B (B:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dp3B (B:)
    sqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvl
    ivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhk
    gmiwqvggtaqvdgkvvaeaelkamiaer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dp3C (C:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dp3C (C:)
    qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
    livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
    kgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dp3D (D:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dp3D (D:)
    lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
    vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
    hkgmiwqvggtaqvdgkvvaeaelkamiaer
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3dp3E (E:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dp3E (E:)
    lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
    vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
    hkgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3dp3F (F:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dp3F (F:)
    sqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvl
    ivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhk
    gmiwqvggtaqvdgkvvaeaelkamiaer