PDB entry 3dow

View 3dow on RCSB PDB site
Description: Complex structure of GABA type A receptor associated protein and its binding epitope on calreticulin
Class: protein transport
Keywords: alpha-beta, beta-grasp fold, Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane, Microtubule, Protein transport, Transport, Calcium, Chaperone, Endoplasmic reticulum, Extracellular matrix, Lectin, Metal-binding, Secreted, Zinc
Deposited on 2008-07-07, released 2009-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.233
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95166 (2-118)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d3dowa1, d3dowa2
  • Chain 'B':
    Compound: CRT peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dowA (A:)
    gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
    qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

  • Chain 'B':
    No sequence available.