PDB entry 3dos

View 3dos on RCSB PDB site
Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Thr7Phe and Ala9Val mutations in the Gd donor strand
Class: Chaperone/Structural Protein
Keywords: BETA BARREL, PROTEIN-PROTEIN COMPLEX, DONOR STRAND COMPLEMENTATION, Chaperone, Immunoglobulin domain, Periplasm, Plasmid, Capsule, Secreted, Chaperone/Structural Protein COMPLEX
Deposited on 2008-07-06, released 2009-07-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M, YPMT1.82, y5194, y1098, YP_pMT084
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dosa1, d3dosa2
  • Chain 'B':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26948 (0-148)
      • engineered (6)
      • engineered (8)
    Domains in SCOPe 2.05: d3dosb_
  • Chain 'C':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dosc_
  • Chain 'D':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M, YPMT1.82, y5194, y1098, YP_pMT084
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dosd1, d3dosd2
  • Chain 'E':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26948 (0-148)
      • engineered (6)
      • engineered (8)
    Domains in SCOPe 2.05: d3dose_
  • Chain 'F':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1, YPMT1.84, y5196, y1100, YP_pMT082
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dosf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dosA (A:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dosA (A:)
    askeygvtigesriiypldaagvmvsvkntqdypvliqsriydenedpfvvtpplfrlda
    kqqnslriaqaggvfprdkeslkwlcvkgippkvgvfvqfainncikllvrpnelkgtpi
    qfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkglagar
    nvswriindqggldrlysknvtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dosB (B:)
    adltasftvtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dosB (B:)
    adltasftvtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklagkytdavtvtvsnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dosC (C:)
    adltasftvtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dosC (C:)
    eparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltf
    tsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkla
    agkytdavtvtvsnq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dosD (D:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dosD (D:)
    skeygvtigesriiypldaagvmvsvkntqdypvliqsriyddpfvvtpplfrldakqqn
    slriaqaggvfprdkeslkwlcvkgippkdvgvfvqfainncikllvrpnelkgtpiqfa
    enlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpnvswriindq
    ggldrlysknv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dosE (E:)
    adltasftvtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3dosF (F:)
    adltasftvtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dosF (F:)
    paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
    sqdgnnhqfttkvigkdsrdfdispkvngengddvvlatgsqdffvrsigskggklaagk
    ytdavtvtvsnq