PDB entry 3dom

View 3dom on RCSB PDB site
Description: Crystal Structure of the complex between Tfb5 and the C-terminal domain of Tfb2
Class: transcription
Keywords: protein-protein complex, heterodimer, beta-alpha-beta split, beta-strand addition, DNA damage, DNA excision, DNA repair, Nucleus, Transcription, Transcription regulation
Deposited on 2008-07-04, released 2008-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TFB2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RNA polymerase II transcription factor B subunit 5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TFB5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3domb_
  • Chain 'C':
    Compound: RNA polymerase II transcription factor B subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TFB2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RNA polymerase II transcription factor B subunit 5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TFB5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3domd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3domB (B:)
ararkgalvqcdpsikalilqidakmsdivleelddthllvnpskvefvkhelnrllskn
iynpmdeeenq

    Sequence, based on observed residues (ATOM records): (download) 
    >3domB (B:)
ararkgalvqcdpsikalilqidakmsdivleelddthllvnpskvefvkhelnrlls

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >3domD (D:)
ararkgalvqcdpsikalilqidakmsdivleelddthllvnpskvefvkhelnrllskn
iynpmdeeenq

    Sequence, based on observed residues (ATOM records): (download) 
    >3domD (D:)
ararkgalvqcdpsikalilqidakmsdivleelddthllvnpskvefvkhelnrllskn
iynpm