PDB entry 3do4

View 3do4 on RCSB PDB site
Description: Crystal structure of transthyretin variant T60A at acidic pH
Class: transport protein
Keywords: TTR, AMYLOID FIBRILS, POINT MUTATION, TRANSPORT PROTEIN, RETINOL-BINDING, THYROID HORMONE, Amyloid, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hormone, Polymorphism, Polyneuropathy, Secreted, Vitamin A
Deposited on 2008-07-03, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (59)
    Domains in SCOPe 2.07: d3do4a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (59)
    Domains in SCOPe 2.07: d3do4b_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (59)
    Domains in SCOPe 2.07: d3do4c_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (59)
    Domains in SCOPe 2.07: d3do4d_
  • Chain 'E':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (59)
    Domains in SCOPe 2.07: d3do4e_
  • Chain 'F':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (59)
    Domains in SCOPe 2.07: d3do4f_
  • Chain 'G':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (59)
    Domains in SCOPe 2.07: d3do4g_
  • Chain 'H':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (59)
    Domains in SCOPe 2.07: d3do4h_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3do4A (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3do4A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3do4B (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3do4B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3do4C (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3do4C (C:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3do4D (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3do4D (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3do4E (E:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3do4E (E:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3do4F (F:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3do4F (F:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3do4G (G:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3do4G (G:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3do4H (H:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglta
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3do4H (H:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp