PDB entry 3dnp

View 3dnp on RCSB PDB site
Description: Crystal structure of Stress response protein yhaX from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: Stress response protein yhaX, Bacillus subtilis, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Stress response, unknown function
Deposited on 2008-07-02, released 2008-07-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stress response protein yhaX
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yhaX, BSU09830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3dnpa_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dnpA (A:)
    snamskqllalnidgallrsngkihqatkdaieyvkkkgiyvtlvtnrhfrsaqkiaksl
    kldaklithsgayiaekidapffekrisddhtfnivqvlesyqcnirllhekysignkkk
    vnsnllgkalihpsdpifypvqfveslsdllmdepvsapvievytehdiqhditetitka
    fpavdvirvndeklnivpkgvskeaglalvaselglsmddvvaighqyddlpmielaglg
    vamgnavpeikrkadwvtrsndeqgvaymmkeyfrmqqrkgfldkfhmkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dnpA (A:)
    kqllalnidgallrsngkihqatkdaieyvkkkgiyvtlvtnrhfrsaqkiakslkldak
    lithsgayiaekidapffekrisddhtfnivqvlesyqcnirllhekysignkkkvnsnl
    lgkalihpsdpifypvqfveslsdllmdepvsapvievytehdiqhditetitkafpavd
    virvndeklnivpkgvskeaglalvaselglsmddvvaighqyddlpmielaglgvamgn
    avpeikrkadwvtrsndeqgvaymmkeyfrmqqrk