PDB entry 3dnj

View 3dnj on RCSB PDB site
Description: The structure of the Caulobacter crescentus ClpS protease adaptor protein in complex with a N-end rule peptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide binding protein
Deposited on 2008-07-02, released 2008-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: clpS, CC_2467
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dnja_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: clpS, CC_2467
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dnjb_
  • Chain 'C':
    Compound: synthetic N-end rule peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DNJ (0-End)
  • Chain 'D':
    Compound: synthetic N-end rule peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DNJ (0-End)
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3dnjA (A:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3dnjA (A:)
lyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetkva
qvidsarrhqhplqctmekd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3dnjB (B:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3dnjB (B:)
slyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetkv
aqvidsarrhqhplqctmekd

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.