PDB entry 3dnj
View 3dnj on RCSB PDB site
Description: The structure of the Caulobacter crescentus ClpS protease adaptor protein in complex with a N-end rule peptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide binding protein
Deposited on
2008-07-02, released
2008-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ATP-dependent Clp protease adapter protein clpS
Species: Caulobacter vibrioides [TaxId:155892]
Gene: clpS, CC_2467
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3dnja_ - Chain 'B':
Compound: ATP-dependent Clp protease adapter protein clpS
Species: Caulobacter vibrioides [TaxId:155892]
Gene: clpS, CC_2467
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3dnjb_ - Chain 'C':
Compound: synthetic N-end rule peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: synthetic N-end rule peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: MG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3dnjA (A:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd
Sequence, based on observed residues (ATOM records): (download)
>3dnjA (A:)
lyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetkva
qvidsarrhqhplqctmekd
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3dnjB (B:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd
Sequence, based on observed residues (ATOM records): (download)
>3dnjB (B:)
slyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetkv
aqvidsarrhqhplqctmekd
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.