PDB entry 3dni

View 3dni on RCSB PDB site
Description: crystallographic refinement and structure of dnase i at 2 angstroms resolution
Deposited on 1992-08-20, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3dni__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >3dni_ (-)
    lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
    ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
    hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
    wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
    lsnemalaisdhypvevtlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dni_ (-)
    lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
    ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgccgndsfsrepavvkfsshs
    tkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqws
    sirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaaygls
    nemalaisdhypvevtlt