PDB entry 3dnc

View 3dnc on RCSB PDB site
Description: Carboxysome shell protein, CcmK2 C-terminal deletion mutant, with a closer spacing between hexamers
Class: structural protein
Keywords: hexamer, STRUCTURAL PROTEIN
Deposited on 2008-07-01, released 2009-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide-concentrating mechanism protein ccmK homolog 2
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ccmK2, sll1028
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72761 (Start-90)
      • expression tag (91)
    Domains in SCOPe 2.08: d3dnca1, d3dnca2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3dncA (A:)
msiavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvsag
ieaanrvnggevlsthiiarphenleyvlpilehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3dncA (A:)
iavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvsagie
aanrvnggevlsthiiarphenleyvlpil