PDB entry 3dn4

View 3dn4 on RCSB PDB site
Description: Iodobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
Class: hydrolase
Keywords: T4 lysozyme, halogen bond, hydrophobic cavity, halogenated benzene, Antimicrobial, Bacteriolytic enzyme, Glycosidase, Hydrolase
Deposited on 2008-07-01, released 2008-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Bacteriophage T4 [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (53)
      • engineered (96)
      • engineered (98)
    Domains in SCOPe 2.08: d3dn4a_
  • Heterogens: PO4, PIH, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3dn4A (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl