PDB entry 3dmu

View 3dmu on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant PHS T62K at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, Calcium, Endonuclease, Membrane, Metal-binding, Nuclease, Secreted, Zymogen
Deposited on 2008-07-01, released 2008-11-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • expression tag (61)
      • expression tag (116)
      • expression tag (123)
      • expression tag (127)
    Domains in SCOPe 2.02: d3dmua_
  • Heterogens: PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dmuA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    fkkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
    heqllrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dmuA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpekygpeasafkkkmvenakkieve
    fdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqakke
    klniws